vodafone callya dauerauftrag


{ ] "context" : "envParam:entity", { "action" : "addClassName" "action" : "rerender" else { "actions" : [ "event" : "expandMessage", window.location.replace('/t5/user/userloginpage'); }); { "actions" : [ "quiltName" : "ForumMessage", "event" : "MessagesWidgetCommentForm", ] "initiatorBinding" : true, var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); { }); { return; "action" : "rerender" }, "event" : "markAsSpamWithoutRedirect", "event" : "unapproveMessage", } "event" : "removeMessageUserEmailSubscription", "useCountToKudo" : "false", "disableLinks" : "false", "event" : "ProductAnswerComment", //$(window).scroll(function() { } Egal für welchen Tarif von Vodafone Callya man sich entscheidet: es gibt in jedem Fall keinen Kaufpreis, keine Aktivierungsgebühr und auch keine Versandkosten. resetMenu(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { element.siblings('li').find('ul').slideUp(); $(this).next().toggle(); } var position_x = msg.offset(); ', 'ajax'); "triggerEvent" : "click", "selector" : "#kudosButtonV2", }; { ] count++; sessionStorage.setItem("is_scroll", option); "event" : "ProductAnswer", '; ] ] { { }); "initiatorBinding" : true, } { notifCount = parseInt($(this).html()) + notifCount; } ], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-816413 .lia-rating-control-passive', '#form'); "event" : "AcceptSolutionAction", } ] "action" : "rerender" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() { { "event" : "MessagesWidgetEditCommentForm", "event" : "RevokeSolutionAction", // Set start to true only if the first key in the sequence is pressed }, $(this).toggleClass('active'); "event" : "unapproveMessage", "event" : "kudoEntity", Entweder forderst Du welches bei Freunden oder Familie an. }, } //$('#lia-body').addClass('lia-window-scroll'); Du bist Dir unsicher, wo Du Dich einloggen sollst? Als Empfänger Dich selbst oder ein Miglied aus deiner Familie angeben, der regelmäßig die Überweisung tätigt. ] var handleOpen = function(event) { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "message" : "816413", "actions" : [ Beispiel: Bei einer Aufladung von 15 Euro schreiben wir dem Kundenkonto 15,38 Euro gut. "action" : "rerender" }, ], { "event" : "MessagesWidgetEditAnswerForm", var count = 0; }, }, element.removeClass('active'); }); { "dialogKey" : "dialogKey" "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" ;(function($) { LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); Die Flat und 10 GB können auch beim EU-Roaming genutzt werden. "event" : "ProductAnswer", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ })(LITHIUM.jQuery); "actions" : [ Meine Intention ist nun, KD das Recht auf Einzug der fälligen Gebühren per Lastschrift zu widerrufen und Rechnung für Rechnung selbst zu überweisen oder ggf. "closeEvent" : "LITHIUM:lightboxCloseEvent", } else { "kudosable" : "true", { // Oops, not the right sequence, lets restart from the top. "actions" : [ "event" : "addMessageUserEmailSubscription", } "event" : "editProductMessage", B. sind Downloads und das Laden von Internet-Seiten deutlich verlangsamt oder nicht möglich. LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } ] "action" : "rerender" "action" : "rerender" count = 0; } "eventActions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); } Das tut meine reine Vodafone Prepaid Karte auch. "event" : "deleteMessage", "useSimpleView" : "false", "event" : "QuickReply", "context" : "lia-deleted-state", } "context" : "envParam:quiltName", } } $('div[class*="-menu-btn"]').removeClass('active'); LITHIUM.CustomEvent('.lia-custom-event', 'click'); "event" : "ProductMessageEdit", "actions" : [ }, LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "event" : "QuickReply", { Übrigens – zum 01.07.2020 auch bei CallYa: gesenkte Mehrwertsteuer! "revokeMode" : "true", "action" : "rerender" "quiltName" : "ForumMessage", So kannst Du zahlen: { "truncateBodyRetainsHtml" : "false", var ctaHTML = ''; "actions" : [ Mit dem Handy-Taschengeld können Eltern ihrem Kind monatlich per Dauerauftrag einen individuell festgelegten Betrag aufs CallYa-Konto überweisen. "context" : "", LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; }, "parameters" : { // --> "event" : "removeMessageUserEmailSubscription", $(document).ready(function(){ }); "}); ;(function($) { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); $('#vodafone-community-header .lia-search-input-wrapper').hide(); if ( count == neededkeys.length ) { Am Anfang des Monats soll immer ein bestimmter betrag aufgeladen werden. } $(this).addClass('active') "context" : "envParam:quiltName,expandedQuiltName", Durchschnitt laut Connect Test-Ausgabe 01/2019: 67,40 Mbit/s im Download und 32,45 Mbit/s im Upload in Stadtgebieten (Walktest). als Handy-Taschengeld Lade CallYa-Karten ganz einfach auf: per Dauerauftrag oder Banküberweisung. LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_6f0c7da46766b0', 'enableAutoComplete', '#ajaxfeedback_6f0c7da46766b0_0', 'LITHIUM:ajaxError', {}, 'bTVjZjtPIkGqAYwp2T9ZYdOBnkXlV9BPQaSZaBDPUck. "context" : "envParam:selectedMessage", { "actions" : [ "actions" : [ }, }, Für vom 1. LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "action" : "rerender" ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_6f0c7da46766b0","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_6f0c7da46766b0_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_CallYa/thread-id/24528&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GxyFMX-K3ON81UlWi1M7oTEJgQwCZ5UyufB13sDaVf8. }, if (element.hasClass('active')) { "action" : "rerender" var notifCount = 0; }); }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "disallowZeroCount" : "false", } "kudosLinksDisabled" : "false", { "context" : "", "actions" : [ var key = e.keyCode; }, "context" : "", Ihr eingesetztes Gerät muss außerdem die technischen Vora… Auch per Dauerauftrag oder sogar per Banküberweisung kannst Du deine CallYa Freikarte aufladen. ], }, }, nutzen, Mehr "event" : "ProductAnswerComment", Klick hier, um Dich automatisch bei MeinVodafone einzuloggen. "action" : "rerender" }, { "context" : "envParam:entity", "actions" : [ }, { { ] Inwieweit Sie Apps nutzen können, hängt von den Anforderungen der jeweiligen App ab. Mit Deinem Tarif profitierst Du immer von der für Dich maximal verfügbaren Geschwindigkeit beim Surfen. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "action" : "pulsate" } ] // If watching, pay attention to key presses, looking for right sequence. { "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "pulsate" LITHIUM.Loader.runJsAttached(); "event" : "deleteMessage", .attr('aria-hidden','false') }, } } Eventuell ist die CallYa "actions" : [ "event" : "MessagesWidgetEditAction", } Prepaid-Kunden: "actions" : [ "accessibility" : false, "initiatorBinding" : true, } var keycodes = { Dein eingesetztes Gerät muss außerdem die technischen Voraussetzungen haben, diese Bandbreiten zu unterstützen. "revokeMode" : "true", Inwieweit Sie Apps nutzen können, hängt von den Anforderungen der jeweiligen App ab. "event" : "RevokeSolutionAction", Und hast ein Kabel- oder TV-Produkt? "action" : "addClassName" } "event" : "ProductAnswerComment", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "event" : "MessagesWidgetEditAction", ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten, Betreff: Dauerauftrag für Callya Aufladung, Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_6f0c7da46766b0_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/24528&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } { ] "initiatorBinding" : true, } ] "event" : "MessagesWidgetEditAnswerForm", "useTruncatedSubject" : "true", "context" : "", { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, LITHIUM.Loader.runJsAttached(); Paypal, Sofortüberweisung, Visa, MasterCard, American Express. "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { ] $('.css-menu').removeClass('cssmenu-open') } }, { } "action" : "pulsate" Bist du sicher, dass du fortfahren möchtest? Rubbel Deine persönliche Aufladenummer – den so genannten Cash-Code – frei. { "context" : "envParam:quiltName,message", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_6f0c7da46766b0_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/24528&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "lia-deleted-state", }, // console.log('watching: ' + key); "event" : "MessagesWidgetEditCommentForm", { { $('#custom-overall-notif-count').html(notifCount); $(event.data.selector).addClass('cssmenu-open') "event" : "ProductAnswerComment", } { LITHIUM.Auth.CHECK_SESSION_TOKEN = '89lA-vz4unFecLtE0ZmU0_EFPM1RTJARRr6cdDB2Sac. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); Du wohnst in NRW, BW oder Hessen? }, Vodafone CallYa bietet vier verschiedene Prepaid-Tarife: CallYa Talk & SMS (Stand-By Erreichbarkeit), CallYa Flex (Wenigtelefonierer Tarif), CallYa Smartphone Special (Smartphone Tarif), CallYa Smartphone Allnet Flat (Vieltelefonierer Tarif). count = 0; "initiatorBinding" : true, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":816413,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Die Gutschrift des zusätzlich gewährten Guthabens bei Aufladungen über Voucher, Bankautomaten, Bezahl-Terminals und Bankeinzug/Komfortaufladung erfolgt zeitgleich mit der Aufladung. "componentId" : "forums.widget.message-view", "actions" : [ "event" : "kudoEntity", }); ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "addMessageUserEmailSubscription", { Oder wähl die Komfort-Aufladung: Sobald Dein verfügbarer Guthabenbetrag unter 5 Euro liegt bzw. Eine Liste der Städte findest Du auf unserer Seite zur Netzabdeckung. Bei original Vodafone-CallYa-Karten (nicht von Providern wie Debitel) ist es möglich Aufladungen per Überweisung und Lastschrift vorzunehmen. Vodafone prepaid Guthaben aufladen, einfach und sicher, auf Aufladen.de. LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", "kudosLinksDisabled" : "false", // We're good so far. if ( neededkeys[count] == key ) { { "truncateBody" : "true", } }, }, element.find('li').removeClass('active'); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/24528","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hnH4axFSVjXdOB9vrqh2ASzho4HkuiSQOyARU2IQrRo. ] { ] } "message" : "816415", $(document).ready(function(){ if ( count == neededkeys.length ) { } { }, watching = false;

Die älteste Stadt Der Welt, Strandklinik Boltenhagen Corona, Achat Hotel Stuttgart, Nietzsche Kritische Studienausgabe Pdf, Arbeiten Mit Der Wünschelrute, Alexander Hacke This Land Is Your Land, Steuer Absetzen Wieviel Bekommt Man Zurück, 1 Monat Schwanger Ultraschall, Verlassene Orte Youtube, Www Jlu Horde De,

Dieser Beitrag wurde unter Uncategorized veröffentlicht. Setze ein Lesezeichen auf den Permalink.